Mouse Anti-EXOSC9 Antibody (CBMOAB-42102FYA)


Cat: CBMOAB-42102FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42102FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO42102FYA 100 µg
CBMOAB-75567FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75567FYA 100 µg
MO-AB-01812Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01812Y 100 µg
MO-AB-03410H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03410C 100 µg
MO-AB-03677W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03677W 100 µg
MO-AB-12194R Monoclonal Cattle (Bos taurus) WB, ELISA MO12194R 100 µg
MO-AB-19068W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19068W 100 µg
MO-AB-55189W Monoclonal Marmoset WB, ELISA MO55189W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO42102FYA
SpecificityThis antibody binds to Rhesus EXOSC9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus EXOSC9 Antibody is a mouse antibody against EXOSC9. It can be used for EXOSC9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEXOSC9
UniProt IDF6XRD0
Protein RefseqThe length of the protein is 456 amino acids long.
The sequence is show below: MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLLERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITAFKMEKAPIDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDLEDSXXXXXXXXKVASRVAGPISTCHHNWLIFLFLIEMVFHHVGQAGLELLTSDAPIILSDSEEEEMIILEPDKNPKKIRTQTTSAKQEKAPSKKPVKRRKKKRAAN.
For Research Use Only | Not For Clinical Use.
Online Inquiry