Mouse Anti-F3 Antibody (CBMOAB-42148FYA)


Cat: CBMOAB-42148FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42148FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO42148FYA 100 µg
CBMOAB-59869FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59869FYC 100 µg
MO-AB-03425H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03425C 100 µg
MO-AB-08040Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08040Y 100 µg
MO-AB-08367W Monoclonal Cat (Felis catus) WB, ELISA MO08367W 100 µg
MO-AB-12226R Monoclonal Cattle (Bos taurus) WB, ELISA MO12226R 100 µg
MO-AB-15210Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15210Y 100 µg
MO-AB-16922W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16922W 100 µg
MO-AB-34737W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34737W 100 µg
MO-AB-38550W Monoclonal Gorilla WB, ELISA MO38550W 100 µg
MO-AB-41632W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41632W 100 µg
MO-AB-55209W Monoclonal Marmoset WB, ELISA MO55209W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO42148FYA
SpecificityThis antibody binds to Rhesus F3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus F3 Antibody is a mouse antibody against F3. It can be used for F3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesF3
UniProt IDF6QHW3
Protein RefseqThe length of the protein is 70 amino acids long.
The sequence is show below: METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPKPINQVYTVQI.
For Research Use Only | Not For Clinical Use.
Online Inquiry