Mouse Anti-F3 Antibody (CBMOAB-42148FYA)
Cat: CBMOAB-42148FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-42148FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO42148FYA | 100 µg | ||
CBMOAB-59869FYC | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO59869FYC | 100 µg | ||
MO-AB-03425H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03425C | 100 µg | ||
MO-AB-08040Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08040Y | 100 µg | ||
MO-AB-08367W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08367W | 100 µg | ||
MO-AB-12226R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12226R | 100 µg | ||
MO-AB-15210Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15210Y | 100 µg | ||
MO-AB-16922W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16922W | 100 µg | ||
MO-AB-34737W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34737W | 100 µg | ||
MO-AB-38550W | Monoclonal | Gorilla | WB, ELISA | MO38550W | 100 µg | ||
MO-AB-41632W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41632W | 100 µg | ||
MO-AB-55209W | Monoclonal | Marmoset | WB, ELISA | MO55209W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
Clone | MO42148FYA |
Specificity | This antibody binds to Rhesus F3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Rhesus F3 Antibody is a mouse antibody against F3. It can be used for F3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | F3 |
UniProt ID | F6QHW3 |
Protein Refseq | The length of the protein is 70 amino acids long. The sequence is show below: METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPKPINQVYTVQI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry