Mouse Anti-FASLG Antibody (CBMOAB-42590FYA)
Cat: CBMOAB-42590FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-42590FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Frog (Xenopus laevis), Human, Chicken, Pig (Sus scrofa), Rhesus, Rat, Pig, Zebrafish (Danio rerio) | WB, ELISA | MO42590FYA | 100 µg | ||
| CBMOAB-76116FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO76116FYA | 100 µg | ||
| MO-AB-03497H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03497C | 100 µg | ||
| MO-AB-08938W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08938W | 100 µg | ||
| MO-AB-12375R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12375R | 100 µg | ||
| MO-AB-25768R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25768R | 100 µg | ||
| MOFY-0522-FY13 | Monoclonal | Human, Chicken | FC, IHC, WB, IP | 100 µg | |||
| MOFY-0722-FY113 | Polyclonal | Rhesus, Human | WB, IHC, ICC | 100 µg | |||
| MOFY-0722-FY431 | Polyclonal | Rhesus, Human, Rat, Pig | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY438 | Polyclonal | Rhesus | WB, IHC, ICC, IF | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Frog (Xenopus laevis), Human, Chicken, Pig (Sus scrofa), Rhesus, Rat, Pig, Zebrafish (Danio rerio) |
| Clone | MO42590FYA |
| Specificity | This antibody binds to Rhesus FASLG. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation, including activation-induced cell death (AICD) of T cells and cytotoxic T lymphocyte induced cell death. It has also been implicated in the progression of several cancers. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Alternatively spliced transcript variants have been described. |
| Product Overview | Mouse Anti-Rhesus FASLG Antibody is a mouse antibody against FASLG. It can be used for FASLG detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Tumor necrosis factor ligand superfamily member 6; FASLG |
| UniProt ID | F7FBZ7 |
| Protein Refseq | The length of the protein is 132 amino acids long. The sequence is show below: MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELREVTPVHPLRKRSRGKWPI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry