Mouse Anti-FCER1G Antibody (CBMOAB-42742FYA)
Cat: CBMOAB-42742FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-42742FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Guinea pig (Cavia porcellus), Human (Homo sapiens), Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris) | WB, ELISA | MO42742FYA | 100 µg | ||
| MO-AB-41637W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41637W | 100 µg | ||
| MO-AB-12453R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12453R | 100 µg | ||
| MO-AB-25796R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25796R | 100 µg | ||
| MO-AB-25789H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25789C | 100 µg | ||
| MO-DKB-01242W | Polyclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris), Rhesus (Macaca mulatta) | WB, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Guinea pig (Cavia porcellus), Human (Homo sapiens), Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris) |
| Clone | MO42742FYA |
| Specificity | This antibody binds to Rhesus FCER1G. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. |
| Product Overview | Mouse Anti-Rhesus FCER1G Antibody is a mouse antibody against FCER1G. It can be used for FCER1G detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | FCER1G |
| UniProt ID | F6SD41 |
| Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAIASYEKSDGVYTGLSTRNQETYETLKHEKPPQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry