AibGenesis™ Mouse Anti-FCER1G Antibody (CBMOAB-42742FYA)


Cat: CBMOAB-42742FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42742FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Guinea pig (Cavia porcellus), Human (Homo sapiens), Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris) WB, ELISA MO42742FYA 100 µg
MO-AB-41637W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41637W 100 µg
MO-AB-12453R Monoclonal Cattle (Bos taurus) WB, ELISA MO12453R 100 µg
MO-AB-25796R Monoclonal Pig (Sus scrofa) WB, ELISA MO25796R 100 µg
MO-AB-25789H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25789C 100 µg
MO-DKB-01242W Polyclonal Human (Homo sapiens), Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Guinea pig (Cavia porcellus), Human (Homo sapiens), Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris)
CloneMO42742FYA
SpecificityThis antibody binds to Rhesus FCER1G.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. (From NCBI)
Product OverviewMouse Anti-Rhesus FCER1G Antibody is a mouse antibody against FCER1G. It can be used for FCER1G detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFCER1G
UniProt IDF6SD41
Protein RefseqThe length of the protein is 87 amino acids long.
The sequence is show below: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAIASYEKSDGVYTGLSTRNQETYETLKHEKPPQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry