Mouse Anti-FCGR2A Antibody (CBMOAB-42749FYA)


Cat: CBMOAB-42749FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42749FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO42749FYA 100 µg
MO-AB-03705W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03705W 100 µg
MO-AB-25478W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25478W 100 µg
MO-AB-12457R Monoclonal Cattle (Bos taurus) WB, ELISA MO12457R 100 µg
MO-AB-25791H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25791C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO42749FYA
SpecificityThis antibody binds to Rhesus FCGR2A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus FCGR2A Antibody is a mouse antibody against FCGR2A. It can be used for FCGR2A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFCGR2A variant 4; FCGR2A
UniProt IDH9BMP3
Protein RefseqThe length of the protein is 316 amino acids long.
The sequence is show below: MTMETQMSQNVCPSNLWLLQPLTVLLLLASADSQTAPPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNLIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTTHLEFREGETIMLRCHSWKDKPLIKVAFFQNGISKKFSPMNPNFSIPRANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSMGSSSPMGIIVAVVTGIAVAAVVAAVVALIYCRKKRISANSTDPVKAARNEPLGRQTIALRKRQLEETNNDYETADGGYMTLNPRAPTDDDRNIYLTLSPNDYDNSNN.
For Research Use Only | Not For Clinical Use.
Online Inquiry