Mouse Anti-FCGR3A Antibody (CBMOAB-42756FYA)


Cat: CBMOAB-42756FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42756FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Primate, Rat (Rattus norvegicus) WB, ELISA MO42756FYA 100 µg
MO-AB-12459R Monoclonal Cattle (Bos taurus) WB, ELISA MO12459R 100 µg
MO-AB-25792H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25792C 100 µg
MO-NAB-00182W Monoclonal Human (Homo sapiens), Primate, Rhesus (Macaca mulatta) FC, IF, IHC, IP, Neut, SPR 3G8 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Primate, Rat (Rattus norvegicus)
CloneMO42756FYA
SpecificityThis antibody binds to Rhesus FCGR3A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus FCGR3A Antibody is a mouse antibody against FCGR3A. It can be used for FCGR3A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFCGR3A variant 3; FCGR3A
UniProt IDH9BMP9
Protein RefseqThe length of the protein is 290 amino acids long.
The sequence is show below: MGGEAGERLFTSSCLVSLVPLGLRISVVTCPLQRGIMWQLLLPTALLLLVSAGMRAEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQDLAVSSISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKKSVPSSTRDWEDHKFKWSKDPQDK.
For Research Use Only | Not For Clinical Use.
Online Inquiry