Mouse Anti-FCN2 Antibody (CBMOAB-42768FYA)


Cat: CBMOAB-42768FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42768FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa) WB, ELISA MO42768FYA 100 µg
MO-AB-03547H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03547C 100 µg
MO-AB-12465R Monoclonal Cattle (Bos taurus) WB, ELISA MO12465R 100 µg
MO-AB-25801R Monoclonal Pig (Sus scrofa) WB, ELISA MO25801R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa)
CloneMO42768FYA
SpecificityThis antibody binds to Rhesus FCN2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product OverviewMouse Anti-Rhesus FCN2 Antibody is a mouse antibody against FCN2. It can be used for FCN2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFCN2
UniProt IDF7BQY4
Protein RefseqThe length of the protein is 275 amino acids long.
The sequence is show below: MELDRAVRVLGPATLLLTFLGLAWAVQAADTCPGERGPPGPPGKAGPPGSKGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTIFQRRVDGSVDFYRDWAAYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNHQFAKYRSFKVADEKEKYNLVLGAFVEGSAGDSLTSHNNHSFSTKDQDNDLSTGNCAVMYQGAWWYRTCHVSNLNGRYLRGAHDSFANGINWKSGKGYNYSYKVSEMKVRPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry