Mouse Anti-Ferret Casp4 Antibody (MO-AB-34482W)
Cat: MO-AB-34482W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Ferret (Mustela Putorius Furo) |
Clone | MO34482W |
Specificity | This antibody binds to Ferret Casp4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms. |
Product Overview | Mouse Anti-Ferret Casp4 Antibody is a mouse antibody against Casp4. It can be used for Casp4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Caspase 4; Casp4 |
UniProt ID | D7F098 |
Protein Refseq | The length of the protein is 58 amino acids long. The sequence is show below: IAFCSSTPHNVSWRHVTKGSLFIAQLITCFQKYSWCNHLIEVFQKVQQSFEKPDVKAQ. |
See other products for " CASP4 "
MO-AB-43907W | Mouse Anti-Horse CASP4 Antibody (MO-AB-43907W) |
MO-AB-09515R | Mouse Anti-Cattle CASP4 Antibody (MO-AB-09515R) |
MO-AB-29336W | Mouse Anti-Dog CASP4 Antibody (MO-AB-29336W) |
MO-AB-07441Y | Mouse Anti-Rabbit CASP4 Antibody (MO-AB-07441Y) |
MO-AB-52286W | Mouse Anti-Marmoset CASP4 Antibody (MO-AB-52286W) |
MO-AB-07848W | Mouse Anti-Cat CASP4 Antibody (MO-AB-07848W) |
CBMOAB-25711FYC | Mouse Anti-Arabidopsis CASP4 Antibody (CBMOAB-25711FYC) |
CBMOAB-38180FYA | Mouse Anti-Rhesus CASP4 Antibody (CBMOAB-38180FYA) |
MO-AB-11673W | Mouse Anti-Chimpanzee CASP4 Antibody (MO-AB-11673W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry