Mouse Anti-Ferret CCR3 Antibody (MO-AB-34507W)
Cat: MO-AB-34507W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Ferret (Mustela Putorius Furo) |
Clone | MO34507W |
Specificity | This antibody binds to Ferret CCR3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CCR3 (C-C Motif Chemokine Receptor 3) is a Protein Coding gene. Diseases associated with CCR3 include Folliculotropic Mycosis Fungoides and Aids Dementia Complex. Among its related pathways are Akt Signaling and IL1 and megakaryocytes in obesity. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and C-C chemokine receptor activity. An important paralog of this gene is CCR1. |
Product Overview | Mouse Anti-Ferret CCR3 Antibody is a mouse antibody against CCR3. It can be used for CCR3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Chemokine (C-C motif) receptor 3; CCR3 |
UniProt ID | D7F089 |
Protein Refseq | The length of the protein is 77 amino acids long. The sequence is show below: NLVLLLSAFQTIFFETNCEQSKHLDVAMQGAEVIAYTHCCVNPVIYAFVGERFQERLCHFFRRHVVTYMGKYIPFLP. |
See other products for " CCR3 "
MO-AB-24408R | Mouse Anti-Pig CCR3 Antibody (MO-AB-24408R) |
MO-AB-07481Y | Mouse Anti-Rabbit CCR3 Antibody (MO-AB-07481Y) |
CBMOAB-25856FYC | Mouse Anti-Arabidopsis CCR3 Antibody (CBMOAB-25856FYC) |
MO-AB-41358W | Mouse Anti-Guinea pig CCR3 Antibody (MO-AB-41358W) |
MO-DKB-01239W | Rabbit Anti-CCR3 Antibody (MO-DKB-01239W) |
MO-AB-29431W | Mouse Anti-Dog CCR3 Antibody (MO-AB-29431W) |
MO-AB-08263W | Mouse Anti-Cat CCR3 Antibody (MO-AB-08263W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry