Cat: MO-AB-35157W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Ferret (Mustela Putorius Furo) |
Clone | MO35157W |
Specificity | This antibody binds to Ferret MyD88. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Ferret MyD88 (clone MO35157W) Antibody (MO-AB-35157W) is a mouse antibody against MyD88. It can be used for MyD88 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Myeloid differentiation primary response protein 88; MyD88 |
UniProt ID | D7F0A0 |
Protein Refseq | The length of the protein is 41 amino acids long. The sequence is show below: RFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLP. |
See other products for " Myd88 "
CBMOAB-25200FYA | Mouse Anti-D. melanogaster Myd88 Antibody (CBMOAB-25200FYA) |
MO-AB-33429H | Mouse Anti-Nile tilapia Myd88 Antibody (MO-AB-33429H) |
MO-AB-23486H | Mouse Anti-Mallard MyD88 Antibody (MO-AB-23486H) |
MO-AB-12134Y | Mouse Anti-O. mykiss MYD88 Antibody (MO-AB-12134Y) |
MO-AB-00943R | Mouse Anti-Medaka myd88 Antibody (MO-AB-00943R) |
MO-AB-16233Y | Mouse Anti-Sheep MYD88 Antibody (MO-AB-16233Y) |
MO-AB-27438R | Mouse Anti-Pig MYD88 Antibody (MO-AB-27438R) |
MO-AB-59597W | Mouse Anti-Marmoset MYD88 Antibody (MO-AB-59597W) |
MO-NAB-00168W | Mouse Anti-Rhesus MYD88 Antibody (MO-NAB-00168W) |
MO-AB-45610W | Mouse Anti-Horse MYD88 Antibody (MO-AB-45610W) |
For Research Use Only | Not For Clinical Use.