Mouse Anti-Ferret PTPN1 Antibody (MO-AB-35552W)


Cat: MO-AB-35552W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO35552W
SpecificityThis antibody binds to Ferret PTPN1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endosome; Plasma membrane; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity.
Product OverviewMouse Anti-Ferret PTPN1 (clone MO35552W) Antibody (MO-AB-35552W) is a mouse antibody against PTPN1. It can be used for PTPN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTyrosine-protein phosphatase non-receptor type; EC 3.1.3.48; PTPN1
UniProt IDM3Z1H9
Protein RefseqThe length of the protein is 424 amino acids long.
The sequence is show below: MEMEKEFEQIDKAGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTSQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSTEYGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQEQWKELSHEDLEPPPEHVPPPPRPPKRILEPHNGKCKEFFPNHQWVKDETGEDKEDCSIKEETRTPLNVPCSVESTSPDTEVRRRAVGAGPAQGEPSPPKEKQDPALTPWKPFLVNMCMATVLTAGAYLCYRVCFH.
For Research Use Only | Not For Clinical Use.

Online Inquiry