AibGenesis™ Mouse Anti-FGF10 Antibody (CBMOAB-42850FYA)
Cat: CBMOAB-42850FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-42850FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO42850FYA | 100 µg | ||
| MO-AB-00451L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00451L | 100 µg | ||
| MO-AB-01882Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01882Y | 100 µg | ||
| MO-AB-03572H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03572C | 100 µg | ||
| MO-AB-08068Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08068Y | 100 µg | ||
| MO-AB-12515R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12515R | 100 µg | ||
| MO-AB-15247Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15247Y | 100 µg | ||
| MO-AB-23215H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23215C | 100 µg | ||
| MO-AB-25804H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25804C | 100 µg | ||
| MO-AB-25821R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25821R | 100 µg | ||
| MO-AB-30769W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30769W | 100 µg | ||
| MO-AB-34747W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34747W | 100 µg | ||
| MO-AB-44737W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44737W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO42850FYA |
| Specificity | This antibody binds to Rhesus FGF10. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus FGF10 Antibody is a mouse antibody against FGF10. It can be used for FGF10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Fibroblast growth factor; FGF; FGF10 |
| UniProt ID | H9FHS4 |
| Protein Refseq | The length of the protein is 200 amino acids long. The sequence is show below: WILTHCASAFPHLPGCCCCCFLLLFLVSCVPVTCQALGQDMVSPETTNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry