Mouse Anti-FGF10 Antibody (CBMOAB-42850FYA)


Cat: CBMOAB-42850FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42850FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO42850FYA 100 µg
MO-AB-00451L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00451L 100 µg
MO-AB-01882Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01882Y 100 µg
MO-AB-03572H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03572C 100 µg
MO-AB-08068Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08068Y 100 µg
MO-AB-12515R Monoclonal Cattle (Bos taurus) WB, ELISA MO12515R 100 µg
MO-AB-15247Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15247Y 100 µg
MO-AB-23215H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23215C 100 µg
MO-AB-25804H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25804C 100 µg
MO-AB-25821R Monoclonal Pig (Sus scrofa) WB, ELISA MO25821R 100 µg
MO-AB-30769W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30769W 100 µg
MO-AB-34747W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34747W 100 µg
MO-AB-44737W Monoclonal Horse (Equus caballus) WB, ELISA MO44737W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO42850FYA
SpecificityThis antibody binds to Rhesus FGF10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing.
Product OverviewMouse Anti-Rhesus FGF10 Antibody is a mouse antibody against FGF10. It can be used for FGF10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFibroblast growth factor; FGF; FGF10
UniProt IDH9FHS4
Protein RefseqThe length of the protein is 200 amino acids long.
The sequence is show below: WILTHCASAFPHLPGCCCCCFLLLFLVSCVPVTCQALGQDMVSPETTNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry