Mouse Anti-FGF11 Antibody (CBMOAB-42851FYA)
Cat: CBMOAB-42851FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-42851FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO42851FYA | 100 µg | ||
MO-AB-00452L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00452L | 100 µg | ||
MO-AB-00481R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00481R | 100 µg | ||
MO-AB-03574H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03574C | 100 µg | ||
MO-AB-07332W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07332W | 100 µg | ||
MO-AB-08069Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08069Y | 100 µg | ||
MO-AB-15248Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15248Y | 100 µg | ||
MO-AB-25806H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25806C | 100 µg | ||
MO-AB-30770W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30770W | 100 µg | ||
MO-AB-33088H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33088C | 100 µg | ||
MO-AB-34748W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34748W | 100 µg | ||
MO-AB-44738W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44738W | 100 µg | ||
MO-AB-55407W | Monoclonal | Marmoset | WB, ELISA | MO55407W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO42851FYA |
Specificity | This antibody binds to Rhesus FGF11. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this gene has not yet been determined. The expression pattern of the mouse homolog implies a role in nervous system development. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Rhesus FGF11 Antibody is a mouse antibody against FGF11. It can be used for FGF11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Fibroblast growth factor; FGF; FGF11 |
UniProt ID | F6U9K3 |
Protein Refseq | The length of the protein is 225 amino acids long. The sequence is show below: MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLMEVAMYREPSLHSVPEASPSSPPAP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry