Mouse Anti-FLT3LG Antibody (CBMOAB-42992FYA)


Cat: CBMOAB-42992FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42992FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Pig (Sus scrofa) WB, ELISA MO42992FYA 100 µg
MO-AB-08586W Monoclonal Cat (Felis catus) WB, ELISA MO08586W 100 µg
MO-AB-12635R Monoclonal Cattle (Bos taurus) WB, ELISA MO12635R 100 µg
MO-AB-25836W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25836W 100 µg
MO-AB-25873R Monoclonal Pig (Sus scrofa) WB, ELISA MO25873R 100 µg
MO-AB-30816W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30816W 100 µg
MO-AB-55547W Monoclonal Marmoset WB, ELISA MO55547W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Pig (Sus scrofa)
CloneMO42992FYA
SpecificityThis antibody binds to Rhesus FLT3LG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FLT3LG Antibody is a mouse antibody against FLT3LG. It can be used for FLT3LG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFms-related tyrosine kinase 3 ligand; FLT3LG
UniProt IDH9Z6V7
Protein RefseqThe length of the protein is 236 amino acids long.
The sequence is show below: MTVLAPAWSPTTYLLLLLLLSSGLSETQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVPSNLQDEELCGALWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQHPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPRSPGALEATALTAPQRPLLLLLLLLPVGLLLLATAWCLHWQRTRRRTPRPREQVPPVPSPQDLLLVEH.
For Research Use Only | Not For Clinical Use.
Online Inquiry