AibGenesis™ Mouse Anti-FRAT2 Antibody (CBMOAB-43133FYA)


Cat: CBMOAB-43133FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43133FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO43133FYA 100 µg
MO-AB-25888H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25888C 100 µg
MO-AB-55649W Monoclonal Marmoset WB, ELISA MO55649W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO43133FYA
SpecificityThis antibody binds to Rhesus FRAT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this intronless gene belongs to the GSK-3-binding protein family. Studies show that this protein plays a role as a positive regulator of the WNT signaling pathway. It may be upregulated in tumor progression. (From NCBI)
Product OverviewMouse Anti-Rhesus FRAT2 Antibody is a mouse antibody against FRAT2. It can be used for FRAT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFRAT2
UniProt IDF7AUX6
Protein RefseqThe length of the protein is 233 amino acids long.
The sequence is show below: MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGAPLRAPGSLAAAVPADKARPPAVPLLLPPASAETVGPAPPGALRCALGDRGRVRGRAAPYCVAELAAGPSALPGPCRRGWLRDAVTSRRLQQRRWTQAGARSGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGCSGPDPIALQPSGSLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry