Cat: MO-AB-36049W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | French-bean |
Clone | MO36049W |
Specificity | This antibody binds to French-bean ACO1. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a bifunctional, cytosolic protein that functions as an essential enzyme in the TCA cycle and interacts with mRNA to control the levels of iron inside cells. When cellular iron levels are high, this protein binds to a 4Fe-4S cluster and functions as an aconitase. Aconitases are iron-sulfur proteins that function to catalyze the conversion of citrate to isocitrate. When cellular iron levels are low, the protein binds to iron-responsive elements (IREs), which are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. When the protein binds to IRE, it results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degraded transferrin receptor mRNA. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jan 2014] |
Product Overview | Mouse Anti-French-bean ACO1 (clone MO36049W) Antibody (MO-AB-36049W) is a mouse antibody against ACO1. It can be used for ACO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 1-aminocyclopropane-1-carboxylate oxidase; ACO1 |
UniProt ID | A7U8B1 |
Protein Refseq | The length of the protein is 266 amino acids long. The sequence is show below: NFPVINFEKLNGEERKDIMEKIKDACENWGFFELVDHGIPHDLLDTVERLTKEHYEKCMEERFKESMASKGLEAIQTEVKDMDWESTFHLRHLPESNISEVPDLVDEYXXXXXXXXXXXXXXEGLRAHTDAGGIILLFQDDQVSGLQLLKDDQWVDVPPMRHSIVVNIGDQLEVITNGKYKSVEHRVIAQTDGTRMSIASFYNPGSDAVIYPAPELLEKEAEEKAQLYPKFVFEDYMNLYAKLKFQAKEPRFEAFKESNFDPIATA. |
See other products for " ACO1 "
MO-AB-34092H | Mouse Anti-Tomato ACO1 Antibody (MO-AB-34092H) |
MO-AB-06893R | Mouse Anti-Cattle ACO1 Antibody (MO-AB-06893R) |
MO-AB-01175H | Mouse Anti-Frog aco1 Antibody (MO-AB-01175H) |
MO-AB-24270W | Mouse Anti-Chimpanzee ACO1 Antibody (MO-AB-24270W) |
MO-DKB-0020RA | Rabbit Anti-ACO1 Antibody (MO-DKB-0020RA) |
MO-AB-36051W | Mouse Anti-French-bean ACO1 Antibody (MO-AB-36051W) |
MO-AB-28222W | Mouse Anti-Cucumber aco1 Antibody (MO-AB-28222W) |
CBMOAB-1533FYC | Mouse Anti-Arabidopsis ACO1 Antibody (CBMOAB-1533FYC) |
MO-AB-38810W | Mouse Anti-Grape ACO1 Antibody (MO-AB-38810W) |
CBMOAB-18474FYB | Mouse Anti-Rice ACO1 Antibody (CBMOAB-18474FYB) |
For Research Use Only | Not For Clinical Use.