Mouse Anti-Frog acad9 Antibody (MO-AB-01159H)


Cat: MO-AB-01159H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01159C
SpecificityThis antibody binds to Frog acad9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the acyl-CoA dehydrogenase family. Members of this family of proteins localize to the mitochondria and catalyze the rate-limiting step in the beta-oxidation of fatty acyl-CoA. The encoded protein is specifically active toward palmitoyl-CoA and long-chain unsaturated substrates. Mutations in this gene cause acyl-CoA dehydrogenase family member type 9 deficiency. Alternate splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against acad9. It can be used for acad9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcad9-prov protein; acad9; acad9-prov
UniProt IDQ6DDF2
Protein RefseqThe length of the protein is 622 amino acids long.
The sequence is show below: MALCYRAGAVLSRRLKGAAGQWTLPFARRIASCIDPSVGLSEEQTEFQKVALDFAAKEMAPHMALWDEKEIFPVETMRKAAQLGFGGIYTQTDVGGSGLSRLDTSIIFEALSTGCVSTTAYMSIHNMCVWMIDTFGNEEQRHRFCPSLCSMDKFASYCLTEPGSGSDAASLLTSAKRDGDCYVLNGSKAFISGGGDTDVYVVMCRTGGSGARGISCLVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCVVPVKNRLGVEGQGFSIAMKGLNGGRINIASCSLGAAHASVLLTRDHLAVRKQFGEPLAHNQYLQFKLADMATRLVTSRLIVRHAADALQNGTGDAATLCAMAKLFATDECFKICNQALQMHGGYGYLKDYAVQQFVRDIRVHQILEGTNEVMRMIVARSILQE.
For Research Use Only | Not For Clinical Use.
Online Inquiry