Mouse Anti-Frog ADH1 Antibody (MO-AB-01248H)


Cat: MO-AB-01248H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01248C
SpecificityThis antibody binds to Frog ADH1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAlcohol dehydrogenase mostly active on ethanol (EtOH), but exhibits broad substrates selectivity for primary and secondary alcohols (e.g. butanol, propyl alcohol, pentanol, isopentanol, ethylene glycol, isopropanol, methanol and tertiary butyl alcohol) (PubMed:23707506). Converts allyl alcohol to highly toxic acryl-aldehyde (PubMed:20508152). Required for survival and acclimation in hypoxic conditions, especially in roots (PubMed:12857811, PubMed:9880346).
Product OverviewThis product is a mouse antibody against ADH1. It can be used for ADH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlcohol dehydrogenase class I; EC 1.1.1.1; ADH1
UniProt IDO93331
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: VINCKAAIAWGPKQPLTIEDIEVAPPKAHEVRVKIVATGICRSDDHVLSGAISDMKFPAILGHEGAGIVESVGEGVKNLKPGDKVIPLFVPQCGECRCCTNSRSNLCDKHDIGPYIGLLLDRTSRFTCKGKPVYNFLSTSTFTEYTVLDEICVAKIDDNAPLEKVCLIGCGFSTGYGSAVNTAKVEPGSSCAVFGLGGVGLSVLIGCKVAGAAKIIGVDTNPDKFAKAKELGATDCINPNDYKEPIHEVLAKMSDGGLDYTFECIGNTKVM.
See other products for " Adh1 "
MO-AB-27241WMouse Anti-Cottonwood Adh1 Antibody (MO-AB-27241W)
CBMOAB-1659FYCMouse Anti-Arabidopsis ADH1 Antibody (CBMOAB-1659FYC)
MO-AB-07087YMouse Anti-Rabbit ADH1 Antibody (MO-AB-07087Y)
MO-DKB-03757WRabbit Anti-ADH1 Antibody (Cat MO-DKB-03757W)
CBMOAB-18515FYBMouse Anti-Rice ADH1 Antibody (CBMOAB-18515FYB)
MO-DKB-03759WRabbit Anti-ADH1 Antibody (Cat MO-DKB-03759W)
MO-DKB-02556WRabbit Anti-ADH1 Antibody (MO-DKB-02556W)
CBMOAB-00128CRMouse Anti-Yeast ADH1 Antibody (CBMOAB-00128CR)
MO-AB-47208WMouse Anti-Maize adh1 Antibody (MO-AB-47208W)
For Research Use Only | Not For Clinical Use.
Online Inquiry