Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Frog adipor1 Antibody (MO-AB-01258H)


Cat: MO-AB-01258H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01258C
SpecificityThis antibody binds to Frog adipor1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene.
Product OverviewThis product is a mouse antibody against adipor1. It can be used for adipor1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdipor1-prov protein; adipor1
UniProt IDQ7ZY04
Protein RefseqThe length of the protein is 381 amino acids long.
The sequence is show below: MATCKPLSSGQECALSKSSSSSRGEADDLELAELGPLLKAGRDKIGQTSSCGDENQAGKVSQEEEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFRSIFRIHTETGNIWTHLLGFVLFLLLGVLTMLRPNMYFMAPLQEKVVFGMFFLGAILCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYAFYCSPQPRLIYLSIVCVLGITAIVVAQWDRFATPKHRPTRAGVFLGLGLSGIVPTLHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFIHLYGISNLQEFRYALEGGCTDDSLL.
For Research Use Only | Not For Clinical Use.

Online Inquiry