Mouse Anti-Frog ca2 Antibody (MO-AB-01989H)


Cat: MO-AB-01989H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01989C
SpecificityThis antibody binds to Frog ca2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against ca2. It can be used for ca2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCa2-prov protein; ca2
UniProt IDQ8AVG8
Protein RefseqThe length of the protein is 260 amino acids long.
The sequence is show below: MAHAWGYGPDNGPSTWHHAFPLAKGEYQSPINIVTAEAKHDHHLKPISIKYDPSTTKVILNNGHAFNVEFDDSENKSVLTGGALTEPYRLKQFHFHWGSCDGHGSEHTVNGVKYEAELHLVHWNTKYGSMAEAVKHCDGLAVVGVFLKVGEAHPGLQKVLDTLNQIPNKGNEAAFNDFDPSVLLPKSLDFWTYKGSLTTPPLLQCVMWHVLKEPITVSNQQLTQLRSLFFNAEGDTPCSMVDNFRPTQPLKGRHIRASFQ.
For Research Use Only | Not For Clinical Use.

Online Inquiry