Mouse Anti-Frog ccs Antibody (MO-AB-02188H)
Cat: MO-AB-02188H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Frog (Xenopus laevis) |
Clone | MO02188C |
Specificity | This antibody binds to Frog ccs. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CCS (Copper Chaperone For Superoxide Dismutase) is a Protein Coding gene. Diseases associated with CCS include Entropion and Amyotrophic Lateral Sclerosis 1. Among its related pathways are Detoxification of Reactive Oxygen Species and Amyotrophic lateral sclerosis (ALS). Gene Ontology (GO) annotations related to this gene include copper ion binding and copper ion transmembrane transporter activity. An important paralog of this gene is SOD1. |
Product Overview | This product is a mouse antibody against ccs. It can be used for ccs detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ccs-prov protein; ccs; ccs-prov |
UniProt ID | Q6DDQ1 |
Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: MEELGSSRALSKFEFAVQMTCEKCAHAVKNVLQDVKGVKEFSINMDSKSVLVETTLLAEEVHRLLETTGRKAVLKGMGTIKSSKYSAVR. |
See other products for " CCS "
MO-AB-09748R | Mouse Anti-Cattle CCS Antibody (MO-AB-09748R) |
CBMOAB-22087FYB | Mouse Anti-Rice CCS Antibody (CBMOAB-22087FYB) |
MO-DKB-0100RA | Rabbit Anti-CCS Antibody (MO-DKB-0100RA) |
CBMOAB-69630FYA | Mouse Anti-Zebrafish ccs Antibody (CBMOAB-69630FYA) |
MO-AB-52508W | Mouse Anti-Marmoset CCS Antibody (MO-AB-52508W) |
MO-AB-24604H | Mouse Anti-Rat Ccs Antibody (MO-AB-24604H) |
MO-AB-38923W | Mouse Anti-Grape CCS Antibody (MO-AB-38923W) |
MO-AB-31217H | Mouse Anti-Soybean CCS Antibody (MO-AB-31217H) |
MO-AB-34255H | Mouse Anti-Tomato CCS Antibody (MO-AB-34255H) |
MO-AB-13536W | Mouse Anti-Chimpanzee ccs Antibody (MO-AB-13536W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry