Mouse Anti-Frog cr2 Antibody (MO-AB-02634H)


Cat: MO-AB-02634H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02634C
SpecificityThis antibody binds to Frog cr2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCR2 (Complement C3d Receptor 2) is a Protein Coding gene. Diseases associated with CR2 include Immunodeficiency, Common Variable, 7 and Systemic Lupus Erythematosus 9. Among its related pathways are Complement and coagulation cascades and 4-1BB Pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and transmembrane signaling receptor activity. An important paralog of this gene is CR1.
Product OverviewThis product is a mouse antibody against cr2. It can be used for cr2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCr2 protein; cr2
UniProt IDB7ZQS2
Protein RefseqThe length of the protein is 191 amino acids long.
The sequence is show below: MLCRDHGRFICITLALLTFYCCKGLALEAAEYSNKGSSNATKEDLLINHNRTIDTFYHLNKDNEKRNQHKTEGLVPFIGLTDSSKLSKHCCNNGGTCVLGSFCVCPMYFTGRHCEYDERAKHCAAKIQHGDWIRKGCRLCRCAYGVLHCFVETQTDCDEVEEEEIHSSAPMEQSSIYLIAFGILFCIYTLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry