Mouse Anti-Frog rsu1 Antibody (MO-AB-07340H)


Cat: MO-AB-07340H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO07340C
SpecificityThis antibody binds to Frog rsu1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors.
Product OverviewThis product is a mouse antibody against rsu1. It can be used for rsu1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC82873 protein; rsu1; MGC82873
UniProt IDQ6GND8
Protein RefseqThe length of the protein is 277 amino acids long.
The sequence is show below: MSKSLKKIVEESREKNVPDIDMCDRGIANMLDVPGLFTLSHITQLILSHNKLTTVPPNIADLKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNGLPRGFGSLPALEVLDLTYNNLNENSLSGNFFYLTTLRALYLSDNDFETLPPDIGKLTKLQIISLRDNDLISLPKEVGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQVGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNK.
For Research Use Only | Not For Clinical Use.
Online Inquiry