Mouse Anti-Fruit fly MAP1A Antibody (MO-AB-02812W)


Cat: MO-AB-02812W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO02812W
SpecificityThis antibody binds to Fruit fly MAP1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The product of this gene is a precursor polypeptide that presumably undergoes proteolytic processing to generate the final MAP1A heavy chain and LC2 light chain. Expression of this gene is almost exclusively in the brain. Studies of the rat microtubule-associated protein 1A gene suggested a role in early events of spinal cord development.
Product OverviewMouse Anti-Fruit fly MAP1A Antibody is a mouse antibody against MAP1A. It can be used for MAP1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMethionine aminopeptidase 1; MAP 1; MetAP 1; EC 3.4.11.18; Peptidase M 1; MAP1A
UniProt IDQ9VC48
Protein RefseqThe length of the protein is 374 amino acids long.
The sequence is show below: MTQKCETTNCGKDATLQCPTCLKLGIKGSFFCSQPCFKGFWKEHKAIHALAAGASNSAEQDGAYNPWPHFRFTGKLRPFPQTPKRTVPNAIQRPDYADHPAGRSLSEEALRGTKIKVLDDEEIEGMRVAGRLGRECLDEGAKAVEVGITTDELDRLVHEAAIERECYPSPLNYYNFPKSCCTSVNEVICHGIPDQRPLQDGDLCNIDVTVYHRGFHGDLNETFFVGNVSEKHKKLVQVTHEALSKAIEFVRPGEKYRDIGNVIQKYVAPHGFSVVRSYCGHGIHRVFHTAPNVPHYAKNSAVGVMAPGHCFTIEPMISVGVQKAETWPDDWTAVTADGLYSAQFEQTLLVNETGCEILTKRRENNGQPWFMDKM.
For Research Use Only | Not For Clinical Use.
Online Inquiry