Mouse Anti-Fruit fly MAP1B Antibody (MO-AB-02813W)


Cat: MO-AB-02813W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO02813W
SpecificityThis antibody binds to Fruit fly MAP1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The product of this gene is a precursor polypeptide that presumably undergoes proteolytic processing to generate the final MAP1B heavy chain and LC1 light chain. Gene knockout studies of the mouse microtubule-associated protein 1B gene suggested an important role in development and function of the nervous system.
Product OverviewMouse Anti-Fruit fly MAP1B Antibody is a mouse antibody against MAP1B. It can be used for MAP1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMethionine aminopeptidase 1; MAP 1; MetAP 1; EC 3.4.11.18; Peptidase M 1; MAP1B
UniProt IDQ9VKV9
Protein RefseqThe length of the protein is 317 amino acids long.
The sequence is show below: MRRIGLLNSLMRQKTTARNLFQFGKVKGDTGKYEQIVSTGQVSPERFVPEEIKKPAYYFKNMPPGNTLGSPEIKSQVQIDAMRLSGRLAARILRECGKLATVGTTTDQIDAFAHERILESKAYPSPLRYAGFPKSICTSINNIACHGIPDDRQLADGDIINIDVTVFLNGYHGDCSETFRVGNVDERGGFLVEATKSCLDQCISLCGPGVEFNEIGKFIDRYCDEHDLASIAAFIGHGIGSYFHGPPEILHYYNEIPGKMQPGMTFTIEPILSLGGAEIAVLQDGWTAISLDGARSAQFEHTILITETGTEILTRDQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry