Mouse Anti-FUCA2 Antibody (CBMOAB-43200FYA)


Cat: CBMOAB-43200FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43200FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO43200FYA 100 µg
CBMOAB-77245FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77245FYA 100 µg
MO-AB-03722H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03722C 100 µg
MO-AB-22824W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22824W 100 µg
MO-AB-55711W Monoclonal Marmoset WB, ELISA MO55711W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO43200FYA
SpecificityThis antibody binds to Rhesus FUCA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a plasma alpha-L-fucosidase, which represents 10-20% of the total cellular fucosidase activity. The protein is a member of the glycosyl hydrolase 29 family, and catalyzes the hydrolysis of the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. This enzyme is essential for Helicobacter pylori adhesion to human gastric cancer cells.
Product OverviewMouse Anti-Rhesus FUCA2 Antibody is a mouse antibody against FUCA2. It can be used for FUCA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFUCA2
UniProt IDF7GAM1
Protein RefseqThe length of the protein is 163 amino acids long.
The sequence is show below: MRPRKLRGLALPLLLLLLLQPPPSPAHSSTRFDPTWESLDARQLPAWFDQAKFGIFIHWGVFSVPSFGSEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADIFQASGAKYIVLTSKHHEATCRNSFMWRKSFDEYWAHTRWHHFCSF.
For Research Use Only | Not For Clinical Use.
Online Inquiry