Mouse Anti-FUT2 Antibody (CBMOAB-33591FYC)
Cat: CBMOAB-33591FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
- Relate Reference Data
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-33591FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) | WB, ELISA | MO33591FC | 100 µg | ||
CBMOAB-43224FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO43224FYA | 100 µg | ||
CBMOAB-04212HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO04212HB | 100 µg | ||
MO-AB-00208W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00208W | 100 µg | ||
MO-AB-55726W | Monoclonal | Marmoset | WB, ELISA | MO55726W | 100 µg | ||
MO-AB-12761R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12761R | 100 µg | ||
MO-AB-08144Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08144Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) |
Clone | MO33591FC |
Specificity | This antibody binds to Arabidopsis FUT2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Golgi apparatus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Nine genes (AtFUT2-10) were identified with 47% to 62% amino acid similarity to the xyloglucan-specific fucosyltransferase AtFUT1. |
Product Overview | Mouse Anti-Arabidopsis FUT2 (clone MO33591FC) Antibody (CBMOAB-33591FYC) is a mouse antibody against FUT2. It can be used for FUT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Fucosyltransferase 2; GDP-L-Fucose:Beta-D-Galactoside 2-Alpha-L-Fucosyltransferase 2; Secretor Blood Group Alpha-2-Fucosyltransferase; Secretor Factor; Fucosyltransferase 2 (Secretor Status Included); Galactoside 2-Alpha-L-Fucosyltransferase 2; Alpha (1,2) Fucosyltransferase; Alpha(1,2)FT 2; Alpha(1,2)FT2 |
UniProt ID | O81053 |
Protein Refseq | The length of the protein is 539 amino acids long. The sequence is show below: MRITEILALFMVLVPVSLVIVAMFGYDQGNGFVQASRFITMEPNVTSSSDDSSLVQRDQEQKDSVDMSLLGGLLVSGFKKESCLSRYQSYLYRKASPYKPSLHLLSKLRAYEELHKRCGPGTRQYTNAERLLKQKQTGEMESQGCKYVVWMSFSGLGNRIISIASVFLYAMLTDRVLLVEGGEQFADLFCEPFLDTTWLLPKDFTLASQFSGFGQNSAHCHGDMLKRKLINESSVSSLSHLYLHLAHDYNEHDKMFFCEEDQNLLKNVPWLIMRTNNFFAPSLFLISSFEEELGMMFPEKGTVFHHLGRYLFHPSNQVWGLITRYYQAYLAKADERIGLQIRVFDEKSGVSPRVTKQIISCVQNENLLPRLSKGEEQYKQPSEEELKLKSVLVTSLTTGYFEILKTMYWENPTVTRDVIGIHQPSHEGHQQTEKLMHNRKAWAEMYLLSLTDKLVISAWSTFGYVAQGLGGLRAWILYKQENQTNPNPPCGRAMSPDPCFHAPPYYDCKAKKGTDTGNVVPHVRHCEDISWGLKLVDNF. |
Reference
Reference | Sarria, R., Wagner, T. A., O'Neill, M. A., Faik, A., Wilkerson, C. G., Keegstra, K., & Raikhel, N. V. (2001). Characterization of a family of Arabidopsis genes related to xyloglucan fucosyltransferase1. Plant Physiology, 127(4), 1595-1606. |
Relate Reference Data
Figure 1 RT-PCR showing the expression pattern of theAtFUT gene family. Southern analysis of RT-PCR products was done for genes that did not produce visible bands on ethidium bromide-stained gels.
Reference: Sarria, R., Wagner, T. A., O'Neill, M. A., Faik, A., Wilkerson, C. G., Keegstra, K., & Raikhel, N. V. (2001). Characterization of a family of Arabidopsis genes related to xyloglucan fucosyltransferase1. Plant Physiology, 127(4), 1595-1606.
For Research Use Only | Not For Clinical Use.
Online Inquiry