Mouse Anti-FUT3 Antibody (CBMOAB-33592FYC)
Cat: CBMOAB-33592FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
- Relate Reference Data
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-33592FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Pig (Sus scrofa), Rhesus (Macaca mulatta) | WB, ELISA | MO33592FC | 100 µg | ||
CBMOAB-43225FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO43225FYA | 100 µg | ||
CBMOAB-04213HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO04213HB | 100 µg | ||
MO-AB-15143W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15143W | 100 µg | ||
MO-AB-12762R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12762R | 100 µg | ||
MO-AB-25952R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25952R | 100 µg | ||
MO-AB-03733H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03733C | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Pig (Sus scrofa), Rhesus (Macaca mulatta) |
Clone | MO33592FC |
Specificity | This antibody binds to Arabidopsis FUT3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Golgi apparatus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | AtFUT3, AtFUT4 and AtFUT5 were expressed in tobacco (Nicotiana tabacum L. cv BY2) suspension culture cells and the resulting proteins did not transfer fucose (Fuc) from GDP-Fuc to tamarind xyloglucan. AtFUT3, AtFUT4, and AtFUT5 were overexpressed in Arabidopsis plants. |
Product Overview | Mouse Anti-Arabidopsis FUT3 (clone MO33592FC) Antibody (CBMOAB-33592FYC) is a mouse antibody against FUT3. It can be used for FUT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Fucosyltransferase 3 (Lewis Blood Group); Blood Group Lewis Alpha-4-Fucosyltransferase; Galactoside 3(4)-L-Fucosyltransferase; Fucosyltransferase III; EC 2.4.1.65; Lewis FT; FucT-III; FT3B; LE |
UniProt ID | F4HVN0 |
Protein Refseq | The length of the protein is 525 amino acids long. The sequence is show below: MKRGKKNSDAGDRLTNSDTRTGSSELNAMMKPSLSSMKTMGLLLAVLMVASVMFSLSVVLRDPPSDDVIETEAASRVLQSRLHQAIESDGGLSEKKAQLGNINLVPSFDKESCLSRYEASLYRKESPFKQSSYLDYRLQRYEDLHRRCGPFTRSYNLTLDKLKSGDRSDGEVSGCRYVIWLNSNGDLGNRMLSLASAFLYALLTNRFLLVELGVDMADLFCEPFPNTTWFLPPEFPLNSHFNEQSLLRNSGNPMVAYRHVVRDSSDQQKLFFCEDSQVLLEETPWLILKADSFFLPSLFSVSSFKQELQMLFPEKDTAFHFLSQYLFHPTNVVWGLITRYYNAYLAKADQRIGIYIGVSESGNEQFQHLIDQILACGTRHKLLPEVDKQRNLPSSQVLNRKSKAVFISSSSPGYFKSIRDVYWENPTVMGEIISVHKPSYKDYQKTPRNMESKRAWAEIYLLSCSDALVVTGLWSSLVEVAHGLGGLKPWVLNKAENGTAHEPYCVKARSIEPCSQATLFHGCKD. |
Reference
Reference | Sarria, R., Wagner, T. A., O'Neill, M. A., Faik, A., Wilkerson, C. G., Keegstra, K., & Raikhel, N. V. (2001). Characterization of a family of Arabidopsis genes related to xyloglucan fucosyltransferase1. Plant Physiology, 127(4), 1595-1606. |
Relate Reference Data
Figure 1 RT-PCR showing the expression pattern of theAtFUT gene family. RT-PCR products stained by ethidium bromide. AtFUT1 was used as a positive control because its RT-PCT product was present in all tissues analyzed.
Reference: Sarria, R., Wagner, T. A., O'Neill, M. A., Faik, A., Wilkerson, C. G., Keegstra, K., & Raikhel, N. V. (2001). Characterization of a family of Arabidopsis genes related to xyloglucan fucosyltransferase1. Plant Physiology, 127(4), 1595-1606.
For Research Use Only | Not For Clinical Use.
Online Inquiry