Mouse Anti-G6PC3 Antibody (CBMOAB-43274FYA)


Cat: CBMOAB-43274FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43274FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO43274FYA 100 µg
CBMOAB-77364FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77364FYA 100 µg
MO-AB-12801R Monoclonal Cattle (Bos taurus) WB, ELISA MO12801R 100 µg
MO-AB-16851W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16851W 100 µg
MO-AB-55763W Monoclonal Marmoset WB, ELISA MO55763W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO43274FYA
SpecificityThis antibody binds to Rhesus G6PC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogenolytic pathways. Mutations in this gene result in autosomal recessive severe congenital neutropenia. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus G6PC3 Antibody is a mouse antibody against G6PC3. It can be used for G6PC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesG6PC3
UniProt IDF6PN26
Protein RefseqThe length of the protein is 202 amino acids long.
The sequence is show below: MPSLAYCTFLLAVGLSRIFILAHFPHQVLAGLITGAVLGWLMTPRVPVERELSFYGLTALALMLGTSLIYWTLFTLGLDLSWSISLAFKWCERPEWIHMDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAQLGNGQKIACLVLAMGLLGPLDWLGHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry