Mouse Anti-GAMT Antibody (CBMOAB-43356FYA)


Cat: CBMOAB-43356FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43356FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Human, Mouse, Rat, Zebrafish, Marmoset, O. mykiss (Oncorhynchus mykiss) WB, ELISA MO43356FYA 100 µg
CBMOAB-77533FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77533FYA 100 µg
MO-AB-11463Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11463Y 100 µg
MO-AB-12882R Monoclonal Cattle (Bos taurus) WB, ELISA MO12882R 100 µg
MO-AB-23228W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23228W 100 µg
MO-AB-25942H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25942C 100 µg
MO-AB-55847W Monoclonal Marmoset WB, ELISA MO55847W 100 µg
MO-DKB-00282W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) ELISA, WB, IHC 100 µg
MO-MMB-0053 Polyclonal Human, Mouse, Rat, Zebrafish WB, IHC, IF 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Human, Mouse, Rat, Zebrafish, Marmoset, O. mykiss (Oncorhynchus mykiss)
CloneMO43356FYA
SpecificityThis antibody binds to Rhesus GAMT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene. Pseudogenes of this gene are found on chromosomes 2 and 13. (From NCBI)
Product OverviewMouse Anti-Rhesus GAMT Antibody is a mouse antibody against GAMT. It can be used for GAMT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGAMT
UniProt IDF6VFK2
Protein RefseqThe length of the protein is 261 amino acids long.
The sequence is show below: MSAPKATPIFAPGENCSPAWGAAPAAYDPADTHLRILGKPVMERWETPYMHSLAAAAASRVGLQVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLQDWAPRQTHKVVPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITTMFEVRPPGVPCGSPGSDLGWGWEGTAGATLLPGEGPFLTPWVGWTVLVHLETKVLCLARRLPGVVAQVCNLSTVGG.
For Research Use Only | Not For Clinical Use.
Online Inquiry