Mouse Anti-GAMT Antibody (CBMOAB-43356FYA)
Cat: CBMOAB-43356FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-43356FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Human, Mouse, Rat, Zebrafish, Marmoset, O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO43356FYA | 100 µg | ||
| CBMOAB-77533FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO77533FYA | 100 µg | ||
| MO-AB-11463Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11463Y | 100 µg | ||
| MO-AB-12882R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12882R | 100 µg | ||
| MO-AB-23228W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23228W | 100 µg | ||
| MO-AB-25942H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25942C | 100 µg | ||
| MO-AB-55847W | Monoclonal | Marmoset | WB, ELISA | MO55847W | 100 µg | ||
| MO-DKB-00282W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | ELISA, WB, IHC | 100 µg | |||
| MO-MMB-0053 | Polyclonal | Human, Mouse, Rat, Zebrafish | WB, IHC, IF | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Human, Mouse, Rat, Zebrafish, Marmoset, O. mykiss (Oncorhynchus mykiss) |
| Clone | MO43356FYA |
| Specificity | This antibody binds to Rhesus GAMT. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene. Pseudogenes of this gene are found on chromosomes 2 and 13. |
| Product Overview | Mouse Anti-Rhesus GAMT Antibody is a mouse antibody against GAMT. It can be used for GAMT detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | GAMT |
| UniProt ID | F6VFK2 |
| Protein Refseq | The length of the protein is 261 amino acids long. The sequence is show below: MSAPKATPIFAPGENCSPAWGAAPAAYDPADTHLRILGKPVMERWETPYMHSLAAAAASRVGLQVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLQDWAPRQTHKVVPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITTMFEVRPPGVPCGSPGSDLGWGWEGTAGATLLPGEGPFLTPWVGWTVLVHLETKVLCLARRLPGVVAQVCNLSTVGG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry