AibGenesis™ Mouse Anti-GAPT Antibody (CBMOAB-43366FYA)


Cat: CBMOAB-43366FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43366FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO43366FYA 100 µg
MO-AB-12893R Monoclonal Cattle (Bos taurus) WB, ELISA MO12893R 100 µg
MO-AB-25949H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25949C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO43366FYA
SpecificityThis antibody binds to Rhesus GAPT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GAPT Antibody is a mouse antibody against GAPT. It can be used for GAPT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGAPT
UniProt IDF7CYV4
Protein RefseqThe length of the protein is 157 amino acids long.
The sequence is show below: MLKSCGNNLVGISVGISLLLLLVVCGIGCVWHCKHHVATRFTLPRFLQRRSSRRKVCTKTFLGPRIVGLRHKISVETQDHKSAVKGNNIHKNYENVEAGPPKVKGKTDKELYENTQQSNFEEHIYGNETSSDYYNFQKPRPSEVPQDEDIYILPDSY.
For Research Use Only | Not For Clinical Use.
Online Inquiry