AibGenesis™ Mouse Anti-Gas41 Antibody (CBMOAB-17261FYA)


Cat: CBMOAB-17261FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-17261FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus) WB, ELISA MO17261FYA 100 µg
MO-AB-02031Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02031Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus)
CloneMO17261FYA
SpecificityThis antibody binds to fruit fly Gas41.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Gas41 Antibody is a mouse antibody against Gas41. It can be used for Gas41 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG9207-PA; LD16161p; Gas41
UniProt IDQ9VM63
Protein RefseqThe length of the protein is 227 amino acids long.
The sequence is show below: MTDFGGDSGGRLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESYANPNRIVVKPPYEITETGWGEFEVIIKIYFNDQSERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLVSESYEEIVFQEPTQILQHYLLLSEQSANGLLTHDTDFEEKKTKTLDNIVNVKQKVKGEIVTLKDKLKLARETISKFKAELAKVQKQPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry