Mouse Anti-GBGT1 Antibody (CBMOAB-43421FYA)


Cat: CBMOAB-43421FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43421FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset WB, ELISA MO43421FYA 100 µg
MO-AB-02039Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02039Y 100 µg
MO-AB-12924R Monoclonal Cattle (Bos taurus) WB, ELISA MO12924R 100 µg
MO-AB-18686W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18686W 100 µg
MO-AB-30915W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30915W 100 µg
MO-AB-55894W Monoclonal Marmoset WB, ELISA MO55894W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset
CloneMO43421FYA
SpecificityThis antibody binds to Rhesus GBGT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a glycosyltransferase that plays a role in the synthesis of Forssman glycolipid (FG), a member of the globoseries glycolipid family. Glycolipids such as FG form attachment sites for the binding of pathogens to cells; expression of this protein may determine host tropism to microorganisms. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus GBGT1 Antibody is a mouse antibody against GBGT1. It can be used for GBGT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGBGT1
UniProt IDF7DUI6
Protein RefseqThe length of the protein is 343 amino acids long.
The sequence is show below: MHRRRLALGLGFCLVGTSLSVLWAYVENWLPVSYVPYYLPCPEIFNMKLHCKREKPLQPVAWSQYPQPKLLEHRPTQLLTLTPWLAPIVSEGTFNPELLQHIYQPLNLTIGVTAFAVGKYTHFIQSFLESAEEFFMRGYRVHYYIFTDNPAAVPGVPLGPHRLLGTIPIQGHSNWEETCMRRMETISQHITKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYYATPRQQFPYERRRVSTAFVADSEGDFYYGGKVFGGQVARVYEFTRGCHMAILADKANGIMAAWREESHLNRRFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISS.
For Research Use Only | Not For Clinical Use.
Online Inquiry