Mouse Anti-GCSAM Antibody (CBMOAB-43482FYA)


Cat: CBMOAB-43482FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43482FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO43482FYA 100 µg
MO-AB-25969H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25969C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO43482FYA
SpecificityThis antibody binds to Rhesus GCSAM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Rhesus GCSAM Antibody is a mouse antibody against GCSAM. It can be used for GCSAM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGCSAM
UniProt IDF7GPF8
Protein RefseqThe length of the protein is 111 amino acids long.
The sequence is show below: MSSTPIQDNIDQTYSEELCYTLIHHQVLCRRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTPRHARSPEDEYELLMPQRISSHFLQQPHPLTAPSETQFSHV.
For Research Use Only | Not For Clinical Use.
Online Inquiry