Mouse Anti-Gnmt Antibody (CBMOAB-17926FYA)


Cat: CBMOAB-17926FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-17926FYA Monoclonal Fruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO17926FYA 100 µg
CBMOAB-43783FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO43783FYA 100 µg
CBMOAB-78220FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78220FYA 100 µg
MO-AB-00565L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00565L 100 µg
MO-AB-08237Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08237Y 100 µg
MO-AB-25953W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25953W 100 µg
MO-AB-26161R Monoclonal Pig (Sus scrofa) WB, ELISA MO26161R 100 µg
MO-AB-56150W Monoclonal Marmoset WB, ELISA MO56150W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO17926FYA
SpecificityThis antibody binds to fruit fly Gnmt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. This protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). Alternative splicing results in multiple transcript variants. Naturally occurring readthrough transcription occurs between the upstream CNPY3 (canopy FGF signaling regulator 3) gene and this gene and is represented with GeneID:107080644.
Product OverviewMouse Anti-D. melanogaster Gnmt Antibody is a mouse antibody against Gnmt. It can be used for Gnmt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG6188; EC 2.1.1.20; RH06404p; Gnmt
UniProt IDQ9VG42
Protein RefseqThe length of the protein is 289 amino acids long.
The sequence is show below: MTTSADSVFVARSDGISAEGVRDQYADGKAAKVWEIFIGDKNSRTDNYKNFLIDMLRNKGCKRVLDVACGTGVDSLMLVEEGFEVVSVDASDKMLKYALKERWARRNEAAFDKWVIEEANWLTLYDDIQEHIQDGFDAVICLGNSFAHLMDGFGDQREHKQAIGNFEKCLKPGGVLLIDHRNYDNILETGATPAKSIYYNTSHTADIKTSVLFYCGKPALVSMDYLIAGNKLTSEFRLSYYPHGLKRFQEILAEIFSAKAKHQLYGDFKEMSQVKNPAFYIHLIEKPQV.
For Research Use Only | Not For Clinical Use.
Online Inquiry