Mouse Anti-Gnpda1 Antibody (CBMOAB-17927FYA)
Cat: CBMOAB-17927FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-17927FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO17927FYA | 100 µg | ||
CBMOAB-78222FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO78222FYA | 100 µg | ||
MO-AB-00566L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00566L | 100 µg | ||
MO-AB-02169Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02169Y | 100 µg | ||
MO-AB-03973H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03973C | 100 µg | ||
MO-AB-08239Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08239Y | 100 µg | ||
MO-AB-08620W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08620W | 100 µg | ||
MO-AB-13195R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13195R | 100 µg | ||
MO-AB-15568Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15568Y | 100 µg | ||
MO-AB-19219W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19219W | 100 µg | ||
MO-AB-23260H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23260C | 100 µg | ||
MO-AB-26067H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26067C | 100 µg | ||
MO-AB-30990W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30990W | 100 µg | ||
MO-AB-34847W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34847W | 100 µg | ||
MO-AB-41747W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41747W | 100 µg | ||
MO-AB-44910W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44910W | 100 µg | ||
MO-AB-56155W | Monoclonal | Marmoset | WB, ELISA | MO56155W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO17927FYA |
Specificity | This antibody binds to fruit fly Gnpda1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Glucosamine-6-phosphate deaminase (EC 3.5.99.6) is an allosteric enzyme that catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium (Arreola et al., 2003 [PubMed 12965206]). |
Product Overview | Mouse Anti-D. melanogaster Gnpda1 Antibody is a mouse antibody against Gnpda1. It can be used for Gnpda1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Glucosamine-6-phosphate isomerase; EC 3.5.99.6; Glucosamine-6-phosphate deaminase; GNPDA; GlcN6P deaminase; Oscillin homolog; Gnpda1 |
UniProt ID | Q9VMP9 |
Protein Refseq | The length of the protein is 273 amino acids long. The sequence is show below: MRLVILETSDSVGKWAAKYVMKRINDFQPSADRYFVLGLPTGSTPLGMYKELIEFHKQGKVSFQYVKTFNMDEYVGLARDHHESYHYFMWNNFFKHIDIEPKNVHILDGNAADLVAECNKFEDQIREAGGVELFIGGIGPDGHIAFNEPGSSLVSRTRVKTLAQDTLEANARFFDNDMSKVPKQALTVGVGTVMDSKEVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHANTLMICDEDATLELRVKTVKYFKGILRDLDEGSPLEGYKN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry