Mouse Anti-GNRH1 Antibody (CBMOAB-43794FYA)


Cat: CBMOAB-43794FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43794FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO43794FYA 100 µg
MO-AB-00567L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00567L 100 µg
MO-AB-08241Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08241Y 100 µg
MO-AB-08262W Monoclonal Cat (Felis catus) WB, ELISA MO08262W 100 µg
MO-AB-11523Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11523Y 100 µg
MO-AB-13200R Monoclonal Cattle (Bos taurus) WB, ELISA MO13200R 100 µg
MO-AB-14520W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14520W 100 µg
MO-AB-15571Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15571Y 100 µg
MO-AB-26069H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26069C 100 µg
MO-AB-30992W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30992W 100 µg
MO-AB-33258H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33258C 100 µg
MO-AB-34849W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34849W 100 µg
MO-AB-41749W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41749W 100 µg
MO-AB-44912W Monoclonal Horse (Equus caballus) WB, ELISA MO44912W 100 µg
MO-AB-56163W Monoclonal Marmoset WB, ELISA MO56163W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO43794FYA
SpecificityThis antibody binds to Rhesus GNRH1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism.
Product OverviewMouse Anti-Rhesus GNRH1 Antibody is a mouse antibody against GNRH1. It can be used for GNRH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGonadoliberin; GNRH1
UniProt IDH9Z0C5
Protein RefseqThe length of the protein is 92 amino acids long.
The sequence is show below: MEPIPKLLAGLILLTVCVEGCSSQHWSYGLRPGGKRDAENLMDSFQEIVKEVGQLAETQHFECTMHQPRSPLQDLKGALESLIEEETGQKKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry