Mouse Anti-GNRH1 Antibody (CBMOAB-43794FYA)
Cat: CBMOAB-43794FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-43794FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO43794FYA | 100 µg | ||
MO-AB-00567L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00567L | 100 µg | ||
MO-AB-08241Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08241Y | 100 µg | ||
MO-AB-08262W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08262W | 100 µg | ||
MO-AB-11523Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11523Y | 100 µg | ||
MO-AB-13200R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13200R | 100 µg | ||
MO-AB-14520W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14520W | 100 µg | ||
MO-AB-15571Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15571Y | 100 µg | ||
MO-AB-26069H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26069C | 100 µg | ||
MO-AB-30992W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30992W | 100 µg | ||
MO-AB-33258H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33258C | 100 µg | ||
MO-AB-34849W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34849W | 100 µg | ||
MO-AB-41749W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41749W | 100 µg | ||
MO-AB-44912W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44912W | 100 µg | ||
MO-AB-56163W | Monoclonal | Marmoset | WB, ELISA | MO56163W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO43794FYA |
Specificity | This antibody binds to Rhesus GNRH1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. |
Product Overview | Mouse Anti-Rhesus GNRH1 Antibody is a mouse antibody against GNRH1. It can be used for GNRH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Gonadoliberin; GNRH1 |
UniProt ID | H9Z0C5 |
Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: MEPIPKLLAGLILLTVCVEGCSSQHWSYGLRPGGKRDAENLMDSFQEIVKEVGQLAETQHFECTMHQPRSPLQDLKGALESLIEEETGQKKI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry