Mouse Anti-GNRH2 Antibody (CBMOAB-43796FYA)


Cat: CBMOAB-43796FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43796FYA Monoclonal Rhesus (Macaca mulatta), Elephant (Loxodonta africana), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) WB, ELISA MO43796FYA 100 µg
CBMOAB-78236FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78236FYA 100 µg
MO-AB-00568L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00568L 100 µg
MO-AB-00613R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00613R 100 µg
MO-AB-11524Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11524Y 100 µg
MO-AB-33259H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33259C 100 µg
MO-AB-56164W Monoclonal Marmoset WB, ELISA MO56164W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Elephant (Loxodonta africana), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio)
CloneMO43796FYA
SpecificityThis antibody binds to Rhesus GNRH2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted peptide hormone and member of the gonadotropin-releasing hormone (GnRH) family of proteins. The encoded protein regulates reproductive function by stimulating the production and release of the gonadotropins follicle-stimulating hormone (FSH) and luteinizing hormone (LH). The encoded protein may inhibit endometrial, ovarian, prostate, and breast cancer cell proliferation. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus GNRH2 Antibody is a mouse antibody against GNRH2. It can be used for GNRH2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGonadoliberin; GNRH2
UniProt IDF6TL78
Protein RefseqThe length of the protein is 121 amino acids long.
The sequence is show below: MASSRRGLLLLLMLLTAHPGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPGRALGTAAGSPAQATYGLPSDALAHLEDSMPWEGRTMAWWSLHRKRYLAQTLLTAAREPRPVPPSSNKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry