Mouse Anti-Gorilla AK6 Antibody (MO-AB-38438W)


Cat: MO-AB-38438W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGorilla
CloneMO38438W
SpecificityThis antibody binds to Gorilla AK6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Gorilla AK6 Antibody is a mouse antibody against AK6. It can be used for AK6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate kinase isoenzyme 6; AK6; EC 2.7.4.3; Coilin-interacting nuclear ATPase protein; Dual activity adenylate kinase / ATPase; TAF9; AK6 CINAP
UniProt IDG3RHN9
Protein RefseqThe length of the protein is 172 amino acids long.
The sequence is show below: MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS.
See other products for " ak6 "
CBMOAB-65350FYAMouse Anti-Zebrafish ak6 Antibody (CBMOAB-65350FYA)
MO-AB-32819HMouse Anti-Nile tilapia AK6 Antibody (MO-AB-32819H)
MO-AB-07136YMouse Anti-Rabbit AK6 Antibody (MO-AB-07136Y)
MO-AB-01321HMouse Anti-Frog ak6 Antibody (MO-AB-01321H)
MO-AB-24018HMouse Anti-Rat Ak6 Antibody (MO-AB-24018H)
MO-AB-50644WMouse Anti-Marmoset AK6 Antibody (MO-AB-50644W)
MO-AB-19963WMouse Anti-Chimpanzee AK6 Antibody (MO-AB-19963W)
MO-AB-00030LMouse Anti-Elephant AK6 Antibody (MO-AB-00030L)
MO-AB-10616YMouse Anti-O. mykiss AK6 Antibody (MO-AB-10616Y)
CBMOAB-1984FYCMouse Anti-Arabidopsis AK6 Antibody (CBMOAB-1984FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry