Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Grape AAT Antibody (MO-AB-38805W)


Cat: MO-AB-38805W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGrape (Vitis vinifera)
CloneMO38805W
SpecificityThis antibody binds to Grape AAT.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Grape AAT (clone MO38805W) Antibody (MO-AB-38805W) is a mouse antibody against AAT. It can be used for AAT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative alanine acetyl transferase; AAT
UniProt IDQ6YEY2
Protein RefseqThe length of the protein is49 amino acids long.
The sequence is show below: LVDVENGGSQRVLEKVGFQREGVLRKFVILKGRCRDLVIYSLLSTDPQP.
For Research Use Only | Not For Clinical Use.

Online Inquiry