Mouse Anti-Grape AAT Antibody (MO-AB-38805W)
Cat: MO-AB-38805W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Grape (Vitis vinifera) |
| Clone | MO38805W |
| Specificity | This antibody binds to Grape AAT. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine. |
| Product Overview | Mouse Anti-Grape AAT Antibody is a mouse antibody against AAT. It can be used for AAT detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Putative alanine acetyl transferase; AAT |
| UniProt ID | Q6YEY2 |
| Protein Refseq | The length of the protein is49 amino acids long. The sequence is show below: LVDVENGGSQRVLEKVGFQREGVLRKFVILKGRCRDLVIYSLLSTDPQP. |
See other products for " AAT "
| MO-AB-30978H | Mouse Anti-Soybean AAT Antibody (MO-AB-30978H) |
| CBMOAB-0006YC | Mouse Anti-E. coli aat Antibody (CBMOAB-0006YC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry