Cat: MO-AB-38805W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Grape (Vitis vinifera) |
Clone | MO38805W |
Specificity | This antibody binds to Grape AAT. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Grape AAT (clone MO38805W) Antibody (MO-AB-38805W) is a mouse antibody against AAT. It can be used for AAT detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Putative alanine acetyl transferase; AAT |
UniProt ID | Q6YEY2 |
Protein Refseq | The length of the protein is49 amino acids long. The sequence is show below: LVDVENGGSQRVLEKVGFQREGVLRKFVILKGRCRDLVIYSLLSTDPQP. |
See other products for " AAT "
MO-AB-30979H | Mouse Anti-Soybean AAT Antibody (MO-AB-30979H) |
MO-AB-30978H | Mouse Anti-Soybean AAT Antibody (MO-AB-30978H) |
CBMOAB-0006YC | Mouse Anti-E. coli aat Antibody (CBMOAB-0006YC) |
For Research Use Only | Not For Clinical Use.