Mouse Anti-Grape ABP1 Antibody (MO-AB-38808W)


Cat: MO-AB-38808W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGrape (Vitis vinifera)
CloneMO38808W
SpecificityThis antibody binds to Grape ABP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRegulates ARP2/3 complex-mediated actin assembly. Recruits ARP2/3 complex to sides of preexisting actin filaments, which may promote nucleation or stabilization of filament branches. Binds to actin filaments, but not actin monomers. Actin binding is required for ARP2/3 complex activation. May also have a role in linking the actin cytoskeleton to endocytosis. recruits components of the endocytotic machinery to cortical actin patches, known sites of endocytosis.
Product OverviewMouse Anti-Grape ABP1 Antibody is a mouse antibody against ABP1. It can be used for ABP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAuxin-binding protein 1; ABP1
UniProt IDB5TGQ0
Protein RefseqThe length of the protein is188 amino acids long.
The sequence is show below: MVGISIIFLILSILLSATAEASQCSAIGLPLVRKINELPQDNYGREGLSHITVAGSLMHGMKEVEVWLQTFSPGSHTPIHRHSCEEVFVVLKGSGTLYLASSSHEKHPGKPQEYPIVSNSIFHIPVNDVHQVWNTNENEDLQMLVIISRPPVKVFIYEDWHMPHTASKLKFPYYWDEQCLQTPPKDEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry