Mouse Anti-Grape ACO1 Antibody (MO-AB-38810W)


Cat: MO-AB-38810W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGrape (Vitis vinifera)
CloneMO38810W
SpecificityThis antibody binds to Grape ACO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a bifunctional, cytosolic protein that functions as an essential enzyme in the TCA cycle and interacts with mRNA to control the levels of iron inside cells. When cellular iron levels are high, this protein binds to a 4Fe-4S cluster and functions as an aconitase. Aconitases are iron-sulfur proteins that function to catalyze the conversion of citrate to isocitrate. When cellular iron levels are low, the protein binds to iron-responsive elements (IREs), which are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. When the protein binds to IRE, it results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degraded transferrin receptor mRNA. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jan 2014]
Product OverviewMouse Anti-Grape ACO1 Antibody is a mouse antibody against ACO1. It can be used for ACO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names1-aminocyclopropane-1-carboxylic acid oxidase 1; ACO1
UniProt IDQ84X67
Protein RefseqThe length of the protein is293 amino acids long.
The sequence is show below: DACENWGFFELVNHGISHELMDTVEKLTKEHYKKCMEQRFKEMVASKGLEAVQSEINDLDWESTFFLRHLPTSNMSEIPDLEEDYRKAMKEFTAHLEKLAELLLDLLCENLGLEKGYLKKAFYGSQGPSFGTKVSNYPPCPQPELIKGLRAHTDAGGIILLFQDDKVSGLQLLKDGQWIDVPPMRHSIVISLGDQLEVITNGKYKGVMHRVIAQTDGNGMSLASFYNPGSDAVIYPAPALVEKEKETSEVYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAMEPTVNLGPIATV.
For Research Use Only | Not For Clinical Use.
Online Inquiry