AibGenesis™ Mouse Anti-GRINA Antibody (CBMOAB-44134FYA)


Cat: CBMOAB-44134FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44134FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO44134FYA 100 µg
MO-AB-04072H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04072C 100 µg
MO-AB-13360R Monoclonal Cattle (Bos taurus) WB, ELISA MO13360R 100 µg
MO-AB-23912W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23912W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO44134FYA
SpecificityThis antibody binds to Rhesus GRINA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GRINA Antibody is a mouse antibody against GRINA. It can be used for GRINA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutamate [NMDA] receptor-associated protein 1; GRINA
UniProt IDH9F6N4
Protein RefseqThe length of the protein is 303 amino acids long.
The sequence is show below: YPQGPYPQGAYPQGPYPQEGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPQAFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATDWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVGEVKGFVRENVWTYYVSYAVFFISLIVLSCCGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry