Mouse Anti-GSTA5 Antibody (CBMOAB-44201FYA)


Cat: CBMOAB-44201FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44201FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO44201FYA 100 µg
MO-AB-13402R Monoclonal Cattle (Bos taurus) WB, ELISA MO13402R 100 µg
MO-AB-26147H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26147C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO44201FYA
SpecificityThis antibody binds to Rhesus GSTA5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe glutathione S-transferases (GST; EC 2.5.1.18) catalyze the conjugation of reduced glutathiones and a variety of electrophiles, including many known carcinogens and mutagens. The cytosolic GSTs belong to a large superfamily, with members located on different chromosomes. For additional information on GSTs, see GSTA1 (MIM 138359). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus GSTA5 Antibody is a mouse antibody against GSTA5. It can be used for GSTA5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione S-transferase; EC 2.5.1.18; GSTA5
UniProt IDA0A023JCA8
Protein RefseqThe length of the protein is 222 amino acids long.
The sequence is show below: MAEKPKLHYLNARGRMEPIRWLLAAAGVEFEEKFLESAEDLDKLRNDGSLLFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGIVDLTEMVLLLITCQPEERDAKTALVKEKIQNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDVKSLEKVRKIFRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry