Mouse Anti-GSTM2 Antibody (CBMOAB-44206FYA)
Cat: CBMOAB-44206FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44206FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Guinea pig (Cavia porcellus), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO44206FYA | 100 µg | ||
| CBMOAB-60161FYC | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO60161FYC | 100 µg | ||
| MO-AB-13408R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13408R | 100 µg | ||
| MO-AB-26152H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26152C | 100 µg | ||
| MO-AB-41776W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41776W | 100 µg | ||
| MO-AB-56455W | Monoclonal | Marmoset | WB, ELISA | MO56455W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Guinea pig (Cavia porcellus), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO44206FYA |
| Specificity | This antibody binds to Rhesus GSTM2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual''s susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene. |
| Product Overview | Mouse Anti-Rhesus GSTM2 Antibody is a mouse antibody against GSTM2. It can be used for GSTM2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Glutathione S-transferase M2; GSTM2 |
| UniProt ID | A0A023JBX5 |
| Protein Refseq | The length of the protein is 218 amino acids long. The sequence is show below: MSMTLGYWNIRGLAHSIRLLLEYTGSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGETEKEKIREDILENQLMDNRMQLARLCYDPDFEKLKPEYLEGLPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry