Mouse Anti-GSTM2 Antibody (CBMOAB-44206FYA)


Cat: CBMOAB-44206FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44206FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Guinea pig (Cavia porcellus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO44206FYA 100 µg
CBMOAB-60161FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60161FYC 100 µg
MO-AB-13408R Monoclonal Cattle (Bos taurus) WB, ELISA MO13408R 100 µg
MO-AB-26152H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26152C 100 µg
MO-AB-41776W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41776W 100 µg
MO-AB-56455W Monoclonal Marmoset WB, ELISA MO56455W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Guinea pig (Cavia porcellus), Marmoset, Rat (Rattus norvegicus)
CloneMO44206FYA
SpecificityThis antibody binds to Rhesus GSTM2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GSTM2 Antibody is a mouse antibody against GSTM2. It can be used for GSTM2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione S-transferase M2; GSTM2
UniProt IDA0A023JBX5
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: MSMTLGYWNIRGLAHSIRLLLEYTGSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGETEKEKIREDILENQLMDNRMQLARLCYDPDFEKLKPEYLEGLPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK.
For Research Use Only | Not For Clinical Use.
Online Inquiry