Mouse Anti-GSTM5 Antibody (CBMOAB-44211FYA)


Cat: CBMOAB-44211FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44211FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO44211FYA 100 µg
MO-AB-26157H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26157C 100 µg
MO-AB-56469W Monoclonal Marmoset WB, ELISA MO56469W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO44211FYA
SpecificityThis antibody binds to Rhesus GSTM5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GSTM5 Antibody is a mouse antibody against GSTM5. It can be used for GSTM5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione S-transferase Mu 5; GSTM5
UniProt IDH9EYF5
Protein RefseqThe length of the protein is 205 amino acids long.
The sequence is show below: MPMTLGYWNIRGLAHSIRLLLEYTGSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGETEEEKILVDILENQLMDSRMEMVRLCFDPNFEKLKPKYLEELPEKLKLYSQFLGKRPWFTGDKITFVDFLAYDVLDMRRIVEPGCLDAFPNLKDFISRFEGLKKISAYMKSSRFLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry