AibGenesis™ Mouse Anti-GSTO1 Antibody (CBMOAB-00077HCB)
Cat: CBMOAB-00077HCB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00077HCB | Monoclonal | C. elegans (Caenorhabditis elegans), A. aegpti (Aedes aegpti), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO00077HB | 100 µg | ||
| CBMOAB-18306FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO18306FYA | 100 µg | ||
| CBMOAB-44212FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO44212FYA | 100 µg | ||
| CBMOAB-78842FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO78842FYA | 100 µg | ||
| CBMOAB-60166FYC | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO60166FYC | 100 µg | ||
| MO-AB-23708W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23708W | 100 µg | ||
| MO-AB-56470W | Monoclonal | Marmoset | WB, ELISA | MO56470W | 100 µg | ||
| MO-AB-13411R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13411R | 100 µg | ||
| MO-AB-04097H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04097C | 100 µg | ||
| MO-AB-26161H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26161C | 100 µg | ||
| MO-AB-05915Y | Monoclonal | A. aegpti (Aedes aegpti) | WB, ELISA | MO05915Y | 100 µg | ||
| MO-AB-11556Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11556Y | 100 µg | ||
| MO-DKB-00861W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta) | WB, IHC, IHC-P, KO | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), A. aegpti (Aedes aegpti), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO00077HB |
| Specificity | This antibody binds to C. elegans GSTO1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-C. elegans GSTO1 Antibody is a mouse antibody against GSTO1. It can be used for GSTO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Glutathione transferase omega-1; EC 2.5.1.18; Glutathione-dependent dehydroascorbate reductase; EC 1.8.5.1; Monomethylarsonic acid reductase; MMA(V) reductase; EC 1.20.4.2; gsto-1 |
| Gene ID | 183000 |
| UniProt ID | P34345 |
| Protein Refseq | The length of the protein is 250 amino acids long. The sequence is show below: MVLTGVTSKAIRKGDAEPPLSKGSFRVYNMRFCPWAERAMLYVAAKGIEAEVVNLNVTDKLEWYWTKHYQGKAPAVEHNGKVVIESGFIPEYLDDAFPETRILPTDPYEKVQQKLLADRLTAVAHAVPLLFAVMRDRTLKDEKQRKVFEVLKQAENLLANDFYAGSQPGYPDYLSFPFFEKIWWSASLDGVVDLPTIEFPGEEEYPKLTKWFQKMISSDVVQSVTQSLEHGAAFMNAYATHQELNYDLGL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry