Mouse Anti-GSTP1 Antibody (CBMOAB-44214FYA)


Cat: CBMOAB-44214FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44214FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO44214FYA 100 µg
CBMOAB-78845FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78845FYA 100 µg
MO-AB-13412R Monoclonal Cattle (Bos taurus) WB, ELISA MO13412R 100 µg
MO-AB-26164H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26164C 100 µg
MO-AB-26252R Monoclonal Pig (Sus scrofa) WB, ELISA MO26252R 100 µg
MO-AB-37394W Monoclonal Goat (Capra hircus) WB, ELISA MO37394W 100 µg
MO-DKB-00626W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO44214FYA
SpecificityThis antibody binds to Rhesus GSTP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGlutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.
Product OverviewMouse Anti-Rhesus GSTP1 Antibody is a mouse antibody against GSTP1. It can be used for GSTP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione S-transferase P; GSTP1
UniProt IDF7A2W2
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: VPPYTVVYFPVRGRCAALRMLLAEQGQSWKEEVVTMETWQEGSLKASCMNWQLKWTGFASRGDSETLVSGLGQTGVSGAGRDESRRMIHGGVWQEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVARLSARPKLKAFLASPEHVNLPINGNGKQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry