Mouse Anti-Guinea pig CCR3 Antibody (MO-AB-41358W)


Cat: MO-AB-41358W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41358W
SpecificityThis antibody binds to Guinea pig CCR3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCR3 (C-C Motif Chemokine Receptor 3) is a Protein Coding gene. Diseases associated with CCR3 include Folliculotropic Mycosis Fungoides and Aids Dementia Complex. Among its related pathways are Akt Signaling and IL1 and megakaryocytes in obesity. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and C-C chemokine receptor activity. An important paralog of this gene is CCR1.
Product OverviewMouse Anti-Guinea pig CCR3 Antibody is a mouse antibody against CCR3. It can be used for CCR3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3; CD antigen CD193; CCR3; CMKBR3
UniProt IDQ9Z2I3
Protein RefseqThe length of the protein is358 amino acids long.
The sequence is show below: MATYPEEAELETEFPGTTFYDYEFAQPCFKVSITDLGAQFLPSLFSLVFIVGLLGNITVIVVLTKYQKLKIMTNIYLLNLAISDLLFLFTLPFWTYYVHWNKWVFGHFMCKIISGLYYVGLFSEIFFIILLTIDRYLAIVHAVFALRTRTVTFGIITSVITWVLAVLAALPEFMFYGTQGHFEVLFCGPSYPEKKEHHWKRFQALRMNIFGLALPLLIMIICYTGIIKTLLRCPSKKKYKAIRLIFVIMVVFFVFWTPYNLLLLFSAFDLSFLDDCERSKQLDMAKHVTEVIAHTHCCINPIIYAFVGERFQKYLRHFLHRNVTMHLSKYIPFFTSEKLERSSSISPSSGDPELSVVF.
For Research Use Only | Not For Clinical Use.
Online Inquiry