Mouse Anti-Guinea pig ITGAM Antibody (MO-AB-41893W)


Cat: MO-AB-41893W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41893W
SpecificityThis antibody binds to Guinea pig ITGAM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Guinea pig ITGAM Antibody is a mouse antibody against ITGAM. It can be used for ITGAM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntegrin alpha-M; CD11 antigen-like family member B; CR-3 alpha chain; Cell surface glycoprotein MAC-1 subunit alpha; Leukocyte adhesion receptor MO1; CD antigen CD11b; ITGAM
UniProt IDP11578
Protein RefseqThe length of the protein is126 amino acids long.
The sequence is show below: QLELPVKYAVYLIVTSGEASTTYLNFTTSEKTIQTMKHQYKFTNLGKRSLPISVVFWVPVRLNNEIVWDRPQVTFSPNLSSACNTEERSPPHSDFLAELEKTHVLNCSIAVCQRIACDIPYFNIQE.
For Research Use Only | Not For Clinical Use.
Online Inquiry